Headquartered is in Little Rock, Arkansas, James Benton Marketing will provided online marketing solutions to all small business client base including leading legal, nonprofit, higher education, moms and pops stores, and retail organizations. The customers I will target are startup business and existing business with poor marketing plans. Located within Pulaski, Faulkner, Saline, Garland, and Lonoke counties. James Benton Marketing Services serves are channel for radio stations and T.V. commercials, complementing their national and local sales efforts. Other services, are website design, billboard sign space, and social media design, email, web hosting, and domain names, SSL Certificates, Sitelock website security, managed wordpress, and in town advertising. Some of our services are web design that is the build of any business or personnal webite withe the services included. For the word to be spread fast and wide we offer radio commercials with a chose of airtime space. And for the big picture we offer billboard space depending on your business's budget. And any online products you my need just visit http://​shop.jamesbentonmarketing.com STRATEGIC PLANNING ​CRAFTING A PLAN TO TAKE YOU THERE OUR APPROACH WHAT WE DO ​​JAMES BENTON MARKETING SERVICES,LLC EXPERT ANALYSIS IDENTIFYING YOUR PATH TO GROWTH
Services/Products
General InfoHeadquartered is in Little Rock, Arkansas, James Benton Marketing will provided online marketing solutions to all small business client base including leading legal, nonprofit, higher education, moms and pops stores, and retail organizations. The customers I will target are startup business and existing business with poor marketing plans. Located within Pulaski, Faulkner, Saline, Garland, and Lonoke counties. James Benton Marketing serves are channel for radio stations and T.V. commercials, complementing their national and local sales efforts. Other services, are website design, billboard sign space, and social media design, email, web hosting, and domain names, SSL Certificates, Sitelock website security, managed wordpress, and in town advertising. Some of our services are web design that is the build of any business or personnal webite withe the services included. For the word to be spread fast and wide we offer radio commercials with a chose of airtime space. And for the big picture we offer billboard space depending on your business's budget. And any online products you my need just visit http//​shop.jamesbentonmarketing.com STRATEGIC PLANNING ​CRAFTING A PLAN TO TAKE YOU THERE OUR APPROACH WHAT WE DO ​​JAMES BENTON MARKETING SERVICES,LLC EXPERT ANALYSIS IDENTIFYING YOUR PATH TO GROWTH,Headquartered is in Little Rock, Arkansas, James Benton Marketing will provided online marketing solutions to all small business client base including leading legal, nonprofit, higher education, moms and pops stores, and retail organizations. The customers I will target are startup business and existing business with poor marketing plans. Located within Pulaski, Faulkner, Saline, Garland, and Lonoke counties. James Benton Marketing serves are channel for radio stations and T.V. commercials, complementing their national and local sales efforts. Other services, are website design, billboard sign space, and social media design, email, web hosting, and domain names, SSL Certificates, Sitelock website security, managed wordpress, and in town advertising. Some of our services are web design that is the build of any business or personnal webite withe the services included. For the word to be spread fast and wide we offer radio commercials with a chose of airtime space. And for the big picture we offer billboard space depending on your business's budget. And any online products you my need just visit http//​shop.jamesbentonmarketing.com STRATEGIC PLANNING ​CRAFTING A PLAN TO TAKE YOU THERE OUR APPROACH WHAT WE DO ​​JAMES BENTON MARKETING SERVICES,LLC EXPERT ANALYSIS IDENTIFYING YOUR PATH TO GROWTH,James Benton Marketing serves are channel for radio stations and T.V. commercials, complementing their national and local sales efforts. Other services, are website design, billboard sign space, and social media design, email, web hosting, and domain names, SSL Certificates, Sitelock website security, managed wordpress, and in town advertising.,James Benton Marketing serves are channel for radio stations and T.V. commercials, complementing their national and local sales efforts. Other services, are website design, billboard sign space, and social media design, email, web hosting, and domain names, SSL Certificates, Sitelock website security, managed wordpress, and in town advertising.
Payment Methods
DISCOVERALL MAJOR CREDIT CARDSVISAMASTERCARDPAYPALCHECKFINANCING AVAILABLE